PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc05364.1.g00010.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family M-type_MADS
Protein Properties Length: 236aa    MW: 24561.9 Da    PI: 9.4437
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc05364.1.g00010.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF68.75.4e-221764249
                                  ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
                        SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                                  rie++  rqv fskRr+g++KKA+ELS+LC+a+va ++fs+ gk + +
  Zpz_sc05364.1.g00010.1.am.mk 17 RIESDEARQVCFSKRRAGLFKKASELSTLCGADVAAVVFSPAGKAFSF 64
                                  8******************************************97766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006625.876868IPR002100Transcription factor, MADS-box
SMARTSM004321.5E-33867IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.88E-28980IPR002100Transcription factor, MADS-box
CDDcd002653.43E-40980No hitNo description
PRINTSPR004041.1E-191030IPR002100Transcription factor, MADS-box
PfamPF003192.9E-261764IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-193045IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-194566IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009960Biological Processendosperm development
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 236 aa     Download sequence    Send to blast
MAPRRPSLGR QKIEIRRIES DEARQVCFSK RRAGLFKKAS ELSTLCGADV AAVVFSPAGK  60
AFSFGHPSVE SILERFLAAS PSCSPSTGGP CGAGSGLSSA GDRAVAELNR QYGELRAMLD  120
VEKARQERAD EAARKERAAG SPAMAWIDAD LAALGQADLT AFSAALAGVR NAVKATADQM  180
LRDAFFVGRR GRPMAQLAGG AFDMSAFGVG APFPPGFVVP GGESQGFGHA ILGPSF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9626542e-90EU962654.1 Zea mays clone 244495 DNA binding protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004953445.11e-105PREDICTED: agamous-like MADS-box protein AGL29
TrEMBLK3Z0901e-105K3Z090_SETIT; Uncharacterized protein
STRINGSi019951m1e-105(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP122436128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.12e-29AGAMOUS-like 61